JARID2 anticorps (N-Term)

N° du produit ABIN633819

Cet anticorps anti-JARID2 est un anticorps Lapin Polyclonal détectant JARID2 dans WB. Adapté pour Humain.

Aperçu rapide pour JARID2 anticorps (N-Term) (ABIN633819)

Antigène: JARID2 (Jumonji, AT Rich Interactive Domain 2 (JARID2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp JARID2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-JARID2 anticorps

Épitope: N-Term

Specificité: JARID2 antibody was raised against the N terminal of JARID2

Purification: Affinity purified

Immunogène: JARID2 antibody was raised using the N terminal of JARID2 corresponding to a region with amino acids THKHVHNGHVFNGSSRSTREKEPVQKHKSKEATPAKEKHSDHRADSRREQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

JARID2 Blocking Peptide, (ABIN5614236), is also available for use as a blocking control in assays to test for specificity of this JARID2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of JARID2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur JARID2

Antigène: JARID2 (Jumonji, AT Rich Interactive Domain 2 (JARID2))

Autre désignation: JARID2

Sujet: This gene is an ortholog of the mouse jumonji gene, which encodes a nuclear protein essential for mouse embryogenesis, including neural tube formation. Overexpression of mouse jumonji negatively regulates cell proliferation.

Poids moléculaire: 139 kDa (MW of target protein)

Pathways: Chromatin Binding